PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09321g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 226aa    MW: 24638.2 Da    PI: 9.2869
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09321g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.7e-401676262
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG+lrn+PvGgg+rkn k+s
  Niben101Scf09321g00005.1 16 EQEHLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGTLRNIPVGGGSRKNAKRS 76
                              57899****************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-27968IPR003851Zinc finger, Dof-type
PfamPF027012.3E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2272074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MQDPSIYTQI KPQFPEQEHL KCPRCDSPNT KFCYYNNYNL SQPRHFCKSC RRYWTKGGTL  60
RNIPVGGGSR KNAKRSSSSS YKRISSSTTS SSVSSSKSDP IANPKPEPFG LPAIPTFDQN  120
SSRVIDMSNG QFSSLLESNG PQFGNLMEAL NTNNNNGSNL QLGEFARNKN TNLGSGSGSD  180
GTRQNGNNTY LGVQNGGDTN NCWNGGSNVL VVNNLLLENM VVKCCA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016489108.11e-116PREDICTED: dof zinc finger protein DOF1.7-like
SwissprotO821552e-45DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLK4BMT93e-76K4BMT9_SOLLC; Uncharacterized protein
STRINGSolyc03g121400.1.17e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-37DOF zinc finger protein 1